Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF6 Peptide - C-terminal region

DCAF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NRIP, ARCAP, IQWD1, PC326, MSTP055, 1200006M05Rik

UniProt

Q58WW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF6 Rabbit Polyclonal Antibody (orb327212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017977.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyltriphenylphosphonium Chloride
TRC-B316160-25G 25 g

Benzyltriphenylphosphonium Chloride

Sign In for Pricing
View Details
VGF Human Gene Knockout Kit (CRISPR)
KN209477 1 Kit

VGF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Actinin α-2/3 Antibody
8C10558-AAT 50 µg

Actinin α-2/3 Antibody

Sign In for Pricing
View Details
DGKA (NM_201445) Human Over-expression Lysate
LC404427 20 µg

DGKA (NM_201445) Human Over-expression Lysate

Sign In for Pricing
View Details
FAK (Ab-397) Antibody
8B0925-AAT 50 µg

FAK (Ab-397) Antibody

Sign In for Pricing
View Details
Ramp2 Mouse Gene Knockout Kit (CRISPR)
KN514451 1 Kit

Ramp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details