Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB3 Peptide - middle region

SERPINB3 Peptide - middle region

Product Specifications

Product Name Alternative

SERPINB3, SCCA, SCCA1

UniProt

P29508

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB3 Rabbit Polyclonal Antibody (orb578427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005266794

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ELF3 Protein
E30P10570 20 µg

Recombinant Human ELF3 Protein

Sign In for Pricing
View Details
EIF4G3 ORF Vector (Human) (pORF)
19174011 1.0 µg DNA

EIF4G3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DRAP1 Rabbit Polyclonal Antibody
orb626519-01 50 µg

DRAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DRAP1 Rabbit Polyclonal Antibody
orb626519-02 100 µg

DRAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RUFY3 Rabbit pAb
E2511220 100 µL

RUFY3 Rabbit pAb

Sign In for Pricing
View Details
Anti-SHMT1 Antibody Picoband®, FITC Conjugate
A02944-1-FITC 100 µg/Vial

Anti-SHMT1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details