Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB3 Peptide - middle region

SERPINB3 Peptide - middle region

Product Specifications

Product Name Alternative

SERPINB3, SCCA, SCCA1

UniProt

P29508

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB3 Rabbit Polyclonal Antibody (orb578427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005266794

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPR3 Peptide
42-909P 0.1 mg

NPR3 Peptide

Sign In for Pricing
View Details
IFT172 Antibody, Biotin conjugated
CSB-PA887019LD01HU-01 50 µg

IFT172 Antibody, Biotin conjugated

Sign In for Pricing
View Details
IFT172 Antibody, Biotin conjugated
CSB-PA887019LD01HU-02 100 µg

IFT172 Antibody, Biotin conjugated

Sign In for Pricing
View Details
B-RAF (Ab-598) Antibody
E11-0780B 100 µg

B-RAF (Ab-598) Antibody

Sign In for Pricing
View Details
Fam188a 3'UTR Luciferase Stable Cell Line
TU204330 1.0 mL

Fam188a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal ZEB1 Antibody (2A8A6) [Alexa Fluor 532]
NBP2-23484AF532 0.1 mL

Mouse Monoclonal ZEB1 Antibody (2A8A6) [Alexa Fluor 532]

Sign In for Pricing
View Details