Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCHIP1 Peptide - C-terminal region

SCHIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCHIP1

UniProt

Q9P0W5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCHIP1 Rabbit Polyclonal Antibody (orb582624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSCSKSGKPSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTETSLDTPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AREG Antibody
KC-3685-01 50 μL

AREG Antibody

Sign In for Pricing
View Details
AREG Antibody
KC-3685-02 100 µL

AREG Antibody

Sign In for Pricing
View Details
AREG Antibody
KC-3685-03 1 mL

AREG Antibody

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF640R conjugate, 0.1mg/mL
BNC402058-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AT-9283
TRC-A790300-5MG 5 mg

AT-9283

Sign In for Pricing
View Details
Mouse Cdkn2a activation kit by CRISPRa
GA200679 1 Kit

Mouse Cdkn2a activation kit by CRISPRa

Sign In for Pricing
View Details