Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCHIP1 Peptide - C-terminal region

SCHIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCHIP1

UniProt

Q9P0W5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCHIP1 Rabbit Polyclonal Antibody (orb582624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSCSKSGKPSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTETSLDTPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35F6 Polyclonal Antibody
E-AB-53176-01 20 µL

SLC35F6 Polyclonal Antibody

Sign In for Pricing
View Details
SLC35F6 Polyclonal Antibody
E-AB-53176-02 60 µL

SLC35F6 Polyclonal Antibody

Sign In for Pricing
View Details
SLC35F6 Polyclonal Antibody
E-AB-53176-03 120 µL

SLC35F6 Polyclonal Antibody

Sign In for Pricing
View Details
SLC35F6 Polyclonal Antibody
E-AB-53176-04 200 µL

SLC35F6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human DES protein (His tag)
PDEH100851-01 20 µg

Recombinant Human DES protein (His tag)

Sign In for Pricing
View Details
Recombinant Human DES protein (His tag)
PDEH100851-02 100 µg

Recombinant Human DES protein (His tag)

Sign In for Pricing
View Details