C10orf55 Peptide - N-terminal region
C10orf55 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C10orf55
UniProt
Q5SWW7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C10orf55 Rabbit Polyclonal Antibody (orb326074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001791
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400043-500 1x 500 µL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741824-500 1x 500 µL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941041-500 1x 500 µL
TRIM29 (TRIM29/1041), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740054-100 1x 100 µL
HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details