Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYCP3 Peptide - N-terminal region

SYCP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SYCP3, SCP3

UniProt

Q8IZU3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYCP3 Rabbit Polyclonal Antibody (orb583961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_710161

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5'-O-DMT-thymidine 3'-Me phosphonamidite
298012-01 250 mg

5'-O-DMT-thymidine 3'-Me phosphonamidite

Sign In for Pricing
View Details
5'-O-DMT-thymidine 3'-Me phosphonamidite
298012-02 500 mg

5'-O-DMT-thymidine 3'-Me phosphonamidite

Sign In for Pricing
View Details
5'-O-DMT-thymidine 3'-Me phosphonamidite
298012-03 1 g

5'-O-DMT-thymidine 3'-Me phosphonamidite

Sign In for Pricing
View Details
BEGAIN (NM_020836) Human Recombinant Protein
TP300943 20 µg

BEGAIN (NM_020836) Human Recombinant Protein

Sign In for Pricing
View Details
Flot1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7064205 3x 1.0 µg

Flot1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
COPA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV669751 1.0 µg DNA

COPA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details