KBTBD6 Peptide - middle region
KBTBD6 Peptide - middle region
Product Specifications
Product Name Alternative
KBTBD6
UniProt
Q86V97
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KBTBD6 Rabbit Polyclonal Antibody (orb327007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_690867
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPI
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS967546-01 0.02 mg (E-Coli)
Recombinant Mouse Cellular nucleic acid-binding protein (Cnbp)
Sign In for Pricing
View Details MBS967546-02 0.1 mg (E-Coli)
Recombinant Mouse Cellular nucleic acid-binding protein (Cnbp)
Sign In for Pricing
View Details MBS967546-03 0.02 mg (Yeast)
Recombinant Mouse Cellular nucleic acid-binding protein (Cnbp)
Sign In for Pricing
View Details MBS967546-04 0.1 mg (Yeast)
Recombinant Mouse Cellular nucleic acid-binding protein (Cnbp)
Sign In for Pricing
View Details MBS967546-05 0.02 mg (Baculovirus)
Recombinant Mouse Cellular nucleic acid-binding protein (Cnbp)
Sign In for Pricing
View Details