Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD6 Peptide - middle region

KBTBD6 Peptide - middle region

Product Specifications

Product Name Alternative

KBTBD6

UniProt

Q86V97

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD6 Rabbit Polyclonal Antibody (orb327007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690867

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Osteoprotegerin Ligand (OPGL) ELISA Kit
MBS9359103 Inquire

Pigeon Osteoprotegerin Ligand (OPGL) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Gankyrin Antibody (1F4) [Alexa Fluor 700]
NBP2-59400AF700 0.1 mL

Mouse Monoclonal Gankyrin Antibody (1F4) [Alexa Fluor 700]

Sign In for Pricing
View Details
CheKine Micro Soil Glutaminase (S-GLS) Activity Assay Kit
orb3148365-01 48 Tests

CheKine Micro Soil Glutaminase (S-GLS) Activity Assay Kit

Sign In for Pricing
View Details
CheKine Micro Soil Glutaminase (S-GLS) Activity Assay Kit
orb3148365-02 96 Tests

CheKine Micro Soil Glutaminase (S-GLS) Activity Assay Kit

Sign In for Pricing
View Details
CARD8 Antibody
MBS9404103-01 0.1 mL

CARD8 Antibody

Sign In for Pricing
View Details
CARD8 Antibody
MBS9404103-02 5x 0.1 mL

CARD8 Antibody

Sign In for Pricing
View Details