Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCNN1B Peptide - C-terminal region

SCNN1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCNN1B

UniProt

H3BQ95

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCNN1B Rabbit Polyclonal Antibody (orb587861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lpar4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3832103 1.0 µg DNA

Lpar4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CD235a Antibody (Biotin)
orb1088488 0.1 mg

CD235a Antibody (Biotin)

Sign In for Pricing
View Details
Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)
281518-01 25 g

Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)

Sign In for Pricing
View Details
Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)
281518-02 50 g

Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)

Sign In for Pricing
View Details
Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)
281518-03 100 g

Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)

Sign In for Pricing
View Details
Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)
281518-04 250 g

Lithium Borohydride (ca. 3mol/L in Tetrahydrofuran)

Sign In for Pricing
View Details