Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCNN1B Peptide - C-terminal region

SCNN1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCNN1B

UniProt

H3BQ95

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCNN1B Rabbit Polyclonal Antibody (orb587861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR5T2 knockout cell line
ABC-KH10860 1 Vial

Human OR5T2 knockout cell line

Sign In for Pricing
View Details
Porcine Protein Kinase C Delta PKCd ELISA Kit
BG-POR11809 1 Each

Porcine Protein Kinase C Delta PKCd ELISA Kit

Sign In for Pricing
View Details
RNF139 Antibody
GWB-MP363C 50 µg

RNF139 Antibody

Sign In for Pricing
View Details
TRIM25 Rabbit Polyclonal Antibody
TA382812 100 µL

TRIM25 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diclofenamic acid-d5
CS-O-62970 1 Each

Diclofenamic acid-d5

Sign In for Pricing
View Details
Rabbit Polyclonal HSP90 alpha Antibody [DyLight 650]
NBP1-77682C 0.1 mL

Rabbit Polyclonal HSP90 alpha Antibody [DyLight 650]

Sign In for Pricing
View Details