Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGR2 Peptide - middle region

EGR2 Peptide - middle region

Product Specifications

Product Name Alternative

EGR2, KROX20

UniProt

P11161

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EGR2 Rabbit Polyclonal Antibody (orb331401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129651

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP8 Rabbit mAb
MBS4762668-01 0.1 mL

MMP8 Rabbit mAb

Sign In for Pricing
View Details
MMP8 Rabbit mAb
MBS4762668-02 5x 0.1 mL

MMP8 Rabbit mAb

Sign In for Pricing
View Details
Human VAMP-7 Recombinant Protein
PROTP51809-500ug 500 µg

Human VAMP-7 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens Translation initiation factor IF-3 (infC)
MBS1471618-01 0.02 mg (E-Coli)

Recombinant Geobacter sulfurreducens Translation initiation factor IF-3 (infC)

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens Translation initiation factor IF-3 (infC)
MBS1471618-02 0.1 mg (E-Coli)

Recombinant Geobacter sulfurreducens Translation initiation factor IF-3 (infC)

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens Translation initiation factor IF-3 (infC)
MBS1471618-03 0.02 mg (Yeast)

Recombinant Geobacter sulfurreducens Translation initiation factor IF-3 (infC)

Sign In for Pricing
View Details