Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCNA Peptide - N-terminal region

PCNA Peptide - N-terminal region

Product Specifications

Product Name Alternative

PCNA

UniProt

P12004

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCNA Rabbit Polyclonal Antibody (orb587868) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Retinol Binding Protein ELISA Kit
MBS012449-01 48 Well

Mouse Retinol Binding Protein ELISA Kit

Sign In for Pricing
View Details
Mouse Retinol Binding Protein ELISA Kit
MBS012449-02 96 Well

Mouse Retinol Binding Protein ELISA Kit

Sign In for Pricing
View Details
Mouse Retinol Binding Protein ELISA Kit
MBS012449-03 5x 96 Well

Mouse Retinol Binding Protein ELISA Kit

Sign In for Pricing
View Details
Mouse Retinol Binding Protein ELISA Kit
MBS012449-04 10x 96 Well

Mouse Retinol Binding Protein ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 13 (FGF13) Peptide (OVA)
abx651234-01 100 µg

Rat Fibroblast Growth Factor 13 (FGF13) Peptide (OVA)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 13 (FGF13) Peptide (OVA)
abx651234-02 200 µg

Rat Fibroblast Growth Factor 13 (FGF13) Peptide (OVA)

Sign In for Pricing
View Details