Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCNA Peptide - N-terminal region

PCNA Peptide - N-terminal region

Product Specifications

Product Name Alternative

PCNA

UniProt

P12004

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCNA Rabbit Polyclonal Antibody (orb587868) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin like 4 (ANGPTL4) (NM_139314) Human Tagged Lenti ORF Clone
RC205651L2 10 µg

Angiopoietin like 4 (ANGPTL4) (NM_139314) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit
MBS2802659-01 48 Tests

Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit
MBS2802659-02 96 Tests

Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit
MBS2802659-03 5x 96 Tests

Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit
MBS2802659-04 10x 96 Tests

Fish Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
ALDH3A1, ID (ALDHIII, Aldehyde Dehydrogenase Family 3 Member A1, Aldehyde Dehydrogenase 3, Aldehyde Dehydrogenase, Dimeric NADP-preferring, ALDH3) (MaxLight 490) discontinued
A1334-33M1-ML490 100 µL

ALDH3A1, ID (ALDHIII, Aldehyde Dehydrogenase Family 3 Member A1, Aldehyde Dehydrogenase 3, Aldehyde Dehydrogenase, Dimeric NADP-preferring, ALDH3) (MaxLight 490) discontinued

Sign In for Pricing
View Details