Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1 Peptide - N-terminal region

HIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HIP1

UniProt

O00291

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1 Rabbit Polyclonal Antibody (orb587910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Cartilage acidic protein 1 (CRTAC1) ELISA Kit
GTR10345386 96 Well

Canine Cartilage acidic protein 1 (CRTAC1) ELISA Kit

Sign In for Pricing
View Details
Anti-Frizzled 9/FZD9 Antibody Picoband®
A08165-2-carrier-free 100 µg/Vial

Anti-Frizzled 9/FZD9 Antibody Picoband®

Sign In for Pricing
View Details
FE65 Polyclonal Antibody, RBITC Conjugated
bs-0110R-RBITC 100 µL

FE65 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Clec14a siRNA Oligos set (Rat)
16296176 3x 5 nmol

Clec14a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Human Vimentin Protein
NBP2-35139-1mg 1 mg

Recombinant Human Vimentin Protein

Sign In for Pricing
View Details
Human HSPG2 (Heparan Sulfate Proteoglycan 2) ELISA Kit
MBS8801975-01 48 Well

Human HSPG2 (Heparan Sulfate Proteoglycan 2) ELISA Kit

Sign In for Pricing
View Details