Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE10A Peptide - N-terminal region

PDE10A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDE10A

UniProt

Q9Y233

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE10A Rabbit Polyclonal Antibody (orb587936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR2A Rabbit Polyclonal Antibody
E10G03770 100 µL

ACVR2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Inhibitor rno-miR-125b-1-3p AAV miRNA Vector
Amr3005100 500 ng

Inhibitor rno-miR-125b-1-3p AAV miRNA Vector

Sign In for Pricing
View Details
(2- (Allylamino) -4-aminothiazol-5-yl) (4-bromophenyl) methanone
OR1005536 100 mg

(2- (Allylamino) -4-aminothiazol-5-yl) (4-bromophenyl) methanone

Sign In for Pricing
View Details
Basal Medium MCDB 201
PG023 4X 500ml bottle

Basal Medium MCDB 201

Sign In for Pricing
View Details
Pax6 3'UTR GFP Stable Cell Line
TU265842 1.0 mL

Pax6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Anti-Cytokeratin 6 antibody (Rabbit mAb)
GB151247-100 100 μL

Recombinant Anti-Cytokeratin 6 antibody (Rabbit mAb)

Sign In for Pricing
View Details