Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE10A Peptide - N-terminal region

PDE10A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDE10A

UniProt

Q9Y233

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE10A Rabbit Polyclonal Antibody (orb587936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse NPM3 Protein, His (Fc)-Avi-tagged
NPM3-6166M 50 µg

Recombinant Mouse NPM3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
USH3A shRNA Plasmid (h)
sc-63191-SH 20 µg

USH3A shRNA Plasmid (h)

Sign In for Pricing
View Details
Myeloperoxidase (Myeloperoxidase light chain, Myeloperoxidase heavy chain, MPO) (FITC) discontinued
227085-FITC 100 µL

Myeloperoxidase (Myeloperoxidase light chain, Myeloperoxidase heavy chain, MPO) (FITC) discontinued

Sign In for Pricing
View Details
KPNA2 polyclonal antibody
orb646605-01 50 μL

KPNA2 polyclonal antibody

Sign In for Pricing
View Details
KPNA2 polyclonal antibody
orb646605-02 100 µL

KPNA2 polyclonal antibody

Sign In for Pricing
View Details
KPNA2 polyclonal antibody
orb646605-03 200 µL

KPNA2 polyclonal antibody

Sign In for Pricing
View Details