Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE10A Peptide - N-terminal region

PDE10A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDE10A

UniProt

Q9Y233

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE10A Rabbit Polyclonal Antibody (orb587936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMEM/F12 Without Phenol Red And L-Glutamine And With HEPES 500ml
IDMEMF120319500ML 500 mL

DMEM/F12 Without Phenol Red And L-Glutamine And With HEPES 500ml

Sign In for Pricing
View Details
4- (Hydroxymethyl) phenylacetic acid
FH55166-01 25 g

4- (Hydroxymethyl) phenylacetic acid

Sign In for Pricing
View Details
4- (Hydroxymethyl) phenylacetic acid
FH55166-02 50 g

4- (Hydroxymethyl) phenylacetic acid

Sign In for Pricing
View Details
4- (Hydroxymethyl) phenylacetic acid
FH55166-03 100 g

4- (Hydroxymethyl) phenylacetic acid

Sign In for Pricing
View Details
4- (Hydroxymethyl) phenylacetic acid
FH55166-04 250 g

4- (Hydroxymethyl) phenylacetic acid

Sign In for Pricing
View Details
4- (Hydroxymethyl) phenylacetic acid
FH55166-05 500 g

4- (Hydroxymethyl) phenylacetic acid

Sign In for Pricing
View Details