Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK17 Peptide - C-terminal region

CDK17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDK17, PCTAIRE2, PCTK2

UniProt

Q00537

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK17 Rabbit Polyclonal Antibody (orb327214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002586

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-1RII (G-5) Alexa Fluor® 488
sc-376247 AF488 200 µg/mL

IL-1RII (G-5) Alexa Fluor® 488

Sign In for Pricing
View Details
F-box only protein 40 Antibody (Carrier-free)
orb3166114 100 µg

F-box only protein 40 Antibody (Carrier-free)

Sign In for Pricing
View Details
Recombinant Bromodomain Containing Protein 8 (BRD8)
MBS2029101-01 0.01 mg

Recombinant Bromodomain Containing Protein 8 (BRD8)

Sign In for Pricing
View Details
Recombinant Bromodomain Containing Protein 8 (BRD8)
MBS2029101-02 0.05 mg

Recombinant Bromodomain Containing Protein 8 (BRD8)

Sign In for Pricing
View Details
Recombinant Bromodomain Containing Protein 8 (BRD8)
MBS2029101-03 0.1 mg

Recombinant Bromodomain Containing Protein 8 (BRD8)

Sign In for Pricing
View Details
Recombinant Bromodomain Containing Protein 8 (BRD8)
MBS2029101-04 0.2 mg

Recombinant Bromodomain Containing Protein 8 (BRD8)

Sign In for Pricing
View Details