Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT1 Peptide - middle region

DMRT1 Peptide - middle region

Product Specifications

Product Name Alternative

DMRT1

UniProt

H3BN61

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMRT1 Rabbit Polyclonal Antibody (orb573711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A13 (NM_001190997) Human Over-expression Lysate
LY434282 100 µg

SLC6A13 (NM_001190997) Human Over-expression Lysate

Sign In for Pricing
View Details
HNRNPuL2 (NM_001079559) Human Over-expression Lysate
LY421528 100 µg

HNRNPuL2 (NM_001079559) Human Over-expression Lysate

Sign In for Pricing
View Details
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF568 conjugate, 0.1mg/mL
BNC683635-500 1x 500 µL

Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF366 (C-term) Rabbit Polyclonal Antibody
AP54696PU-N 400 µL

ZNF366 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 3A7 Antibody
8C21003-AAT 50 µg

Cytochrome P450 3A7 Antibody

Sign In for Pricing
View Details
HOMER2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]
TA806311AM 100 µL

HOMER2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details