Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B1 Peptide - C-terminal region

ATP1B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATP1B1, ATP1B

UniProt

P05026

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP1B1 Rabbit Polyclonal Antibody (orb330386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) Human Gene Knockout Kit (CRISPR)
KN209570BN 1 Kit

Cytokeratin 8 (KRT8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eurycomanone
TRC-E939010-5MG 5 mg

Eurycomanone

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3204
BAVT-3204 1 Unit

Vertical Autoclave BAVT-3204

Sign In for Pricing
View Details
ZNF707 (NM_001100599) Human Over-expression Lysate
LY420277 100 µg

ZNF707 (NM_001100599) Human Over-expression Lysate

Sign In for Pricing
View Details
VRK2 antibody
FNab09452 100 µg

VRK2 antibody

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit
RD-CCR4-Hu-01 96 Tests

Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit

Sign In for Pricing
View Details