Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B1 Peptide - C-terminal region

ATP1B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATP1B1, ATP1B

UniProt

P05026

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP1B1 Rabbit Polyclonal Antibody (orb330386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast, right
CS715597 5x 5 µm

Tissue FFPE Sections, Breast, right

Sign In for Pricing
View Details
R-(+)-Nicotine
TRC-N412430-50MG 50 mg

R-(+)-Nicotine

Sign In for Pricing
View Details
MIX23 (NM_001017928) Human Over-expression Lysate
LY422757 100 µg

MIX23 (NM_001017928) Human Over-expression Lysate

Sign In for Pricing
View Details
Sarcomeric Alpha Actinin Recombinant Rabbit Monoclonal Antibody [JE45-22]
ET7109-42 100 µL

Sarcomeric Alpha Actinin Recombinant Rabbit Monoclonal Antibody [JE45-22]

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) (NM_001869) Human Recombinant Protein
TP720477XL 1 mg

Carboxypeptidase A2 (CPA2) (NM_001869) Human Recombinant Protein

Sign In for Pricing
View Details
Oxprenolol-d7 Hydrochloride
TRC-O870502-1MG 1 mg

Oxprenolol-d7 Hydrochloride

Sign In for Pricing
View Details