Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP7B Peptide - middle region

ATP7B Peptide - middle region

Product Specifications

Product Name Alternative

ATP7B

UniProt

E7EQQ2

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP7B Rabbit Polyclonal Antibody (orb579206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papilloma Virus Type 11 (HPV) (HRP) discontinued
P3105-30A-HRP 100 µL

Human Papilloma Virus Type 11 (HPV) (HRP) discontinued

Sign In for Pricing
View Details
Transketolase (H-7) Alexa Fluor® 546
sc-390179 AF546 200 µg/mL

Transketolase (H-7) Alexa Fluor® 546

Sign In for Pricing
View Details
Human PIP4K2B Pre-designed siRNA Set B
SI012205B 1 Each

Human PIP4K2B Pre-designed siRNA Set B

Sign In for Pricing
View Details
Prohibitin 2 Monoclonal Antibody
E53M02543 100 µL

Prohibitin 2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traM (traM)
MBS1061927-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Protein traM (traM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traM (traM)
MBS1061927-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Protein traM (traM)

Sign In for Pricing
View Details