Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP7B Peptide - middle region

ATP7B Peptide - middle region

Product Specifications

Product Name Alternative

ATP7B

UniProt

E7EQQ2

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP7B Rabbit Polyclonal Antibody (orb579206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LELP1 Polyclonal Conjugated Antibody
MBS9442013-01 0.1 mL (Biotin)

LELP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LELP1 Polyclonal Conjugated Antibody
MBS9442013-02 0.1 mL (AF350)

LELP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LELP1 Polyclonal Conjugated Antibody
MBS9442013-03 0.1 mL (AF405)

LELP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LELP1 Polyclonal Conjugated Antibody
MBS9442013-04 0.1 mL (AF488)

LELP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LELP1 Polyclonal Conjugated Antibody
MBS9442013-05 0.1 mL (AF555)

LELP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LELP1 Polyclonal Conjugated Antibody
MBS9442013-06 0.1 mL (AF594)

LELP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details