Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP11L2 Peptide - C-terminal region

TCP11L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TCP11L2, hCG_1813015

UniProt

G3V1Z2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP11L2 Rabbit Polyclonal Antibody (orb582796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EILLSFLTPGGNRLRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr665 (NM_001000634) Rat Tagged ORF Clone Lentiviral Particle
RR212380L4V 200 µL

Olr665 (NM_001000634) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Taurine-13C2
TRC-T785315-1.5MG 1.5 mg

Taurine-13C2

Sign In for Pricing
View Details
p300 CT (MaxLight 750)
MBS6246843-01 0.1 mL

p300 CT (MaxLight 750)

Sign In for Pricing
View Details
p300 CT (MaxLight 750)
MBS6246843-02 5x 0.1 mL

p300 CT (MaxLight 750)

Sign In for Pricing
View Details
SEH1
491368 100 µL

SEH1

Sign In for Pricing
View Details
OR8D4 Antibody - C-terminal region : Biotin (ARP71215_P050-Biotin)
ARP71215_P050-Biotin 100 µL

OR8D4 Antibody - C-terminal region : Biotin (ARP71215_P050-Biotin)

Sign In for Pricing
View Details