Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP11L2 Peptide - C-terminal region

TCP11L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TCP11L2, hCG_1813015

UniProt

G3V1Z2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP11L2 Rabbit Polyclonal Antibody (orb582796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EILLSFLTPGGNRLRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Total RNA - Human Adult Normal Tissue: Throat
R1234263-10 10 µg

Total RNA - Human Adult Normal Tissue: Throat

Sign In for Pricing
View Details
Hydrocortisone
B1951-1000 1 g

Hydrocortisone

Sign In for Pricing
View Details
Pazopanib HCl
S1035-10mg 10 mg

Pazopanib HCl

Sign In for Pricing
View Details
Phenol, BP grade 80% aqueous solution
GK2423-1l 1 L

Phenol, BP grade 80% aqueous solution

Sign In for Pricing
View Details
MCFD2 (NM_139279) Human Recombinant Protein
TP302230 20 µg

MCFD2 (NM_139279) Human Recombinant Protein

Sign In for Pricing
View Details
SLC26A6 (m) : 293T Lysate
sc-123605 100 µg - 200 µL

SLC26A6 (m) : 293T Lysate

Sign In for Pricing
View Details