Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA7 Peptide - C-terminal region

HOXA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA7, HOX1A

UniProt

P31268

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA7 Rabbit Polyclonal Antibody (orb583830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF530 Antibody - N-terminal region : FITC (ARP35983_P050-FITC)
ARP35983_P050-FITC 100 µL

ZNF530 Antibody - N-terminal region : FITC (ARP35983_P050-FITC)

Sign In for Pricing
View Details
Anti-Human KDR (C) Rabbit IgG Affintiy Purify
JP18435E 10 µg

Anti-Human KDR (C) Rabbit IgG Affintiy Purify

Sign In for Pricing
View Details
CD45R (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 490)
MBS6253611-01 0.1 mL

CD45R (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 490)

Sign In for Pricing
View Details
CD45R (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 490)
MBS6253611-02 5x 0.1 mL

CD45R (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31
AP77790-01 20 µg

Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31

Sign In for Pricing
View Details
Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31
AP77790-02 100 µg

Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31

Sign In for Pricing
View Details