Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA7 Peptide - C-terminal region

HOXA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA7, HOX1A

UniProt

P31268

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA7 Rabbit Polyclonal Antibody (orb583830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itanistomig Antibody
orb2803440-01 1 mg

Itanistomig Antibody

Sign In for Pricing
View Details
Itanistomig Antibody
orb2803440-02 5 mg

Itanistomig Antibody

Sign In for Pricing
View Details
Itanistomig Antibody
orb2803440-03 10 mg

Itanistomig Antibody

Sign In for Pricing
View Details
SLC22A5 Conjugated Antibody
orb1624873 100 µL

SLC22A5 Conjugated Antibody

Sign In for Pricing
View Details
P63α (C-12) : m-IgG Fc BP-HRP Bundle
sc-528155 1 Kit

P63α (C-12) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Mouse LOXL1 shRNA Plasmid
abx971345-01 150 µg

Mouse LOXL1 shRNA Plasmid

Sign In for Pricing
View Details