Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA7 Peptide - C-terminal region

HOXA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA7, HOX1A

UniProt

P31268

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA7 Rabbit Polyclonal Antibody (orb583830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human CD3-UNLB
MBS674162-01 0.1 mg

Mouse Anti-Human CD3-UNLB

Sign In for Pricing
View Details
Mouse Anti-Human CD3-UNLB
MBS674162-02 5x 0.1 mg

Mouse Anti-Human CD3-UNLB

Sign In for Pricing
View Details
SPG7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]
TA800005BM 100 µL

SPG7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]

Sign In for Pricing
View Details
Ccna2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7048208 1.0 µg DNA

Ccna2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
LARP5 Polyclonal Conjugated Antibody
C27885 100 µL

LARP5 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Hecogenin Acetate
164369 250 mg

Hecogenin Acetate

Sign In for Pricing
View Details