Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA7 Peptide - C-terminal region

HOXA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA7, HOX1A

UniProt

P31268

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA7 Rabbit Polyclonal Antibody (orb583830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHP XL IL-4 Magnetic Luminex Performance Assay
LNHPXL204 1 Kit

NHP XL IL-4 Magnetic Luminex Performance Assay

Sign In for Pricing
View Details
Smpdl3a 3'UTR Lenti-reporter-Luc Vector
44472084 1.0 µg

Smpdl3a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
NDUFA6 (NM_002490) Human Tagged ORF Clone
RC221209 10 µg

NDUFA6 (NM_002490) Human Tagged ORF Clone

Sign In for Pricing
View Details
Conjugated Anti-SIRPα (DM8) antibody, Rabbit mAb
C29620 100 µL

Conjugated Anti-SIRPα (DM8) antibody, Rabbit mAb

Sign In for Pricing
View Details
PCB (PC) (NM_001040716) Human Tagged Lenti ORF Clone
RC221952L1 10 µg

PCB (PC) (NM_001040716) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CD19 (Cluster of Differentiation 19) QuickTest ELISA Kit
MBS7619150-01 48 Well

Human CD19 (Cluster of Differentiation 19) QuickTest ELISA Kit

Sign In for Pricing
View Details