Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA7 Peptide - C-terminal region

HOXA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA7, HOX1A

UniProt

P31268

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA7 Rabbit Polyclonal Antibody (orb583830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3,5-Difluoropyridin-2-yl) boronic acid
JH916868 1 Each

(3,5-Difluoropyridin-2-yl) boronic acid

Sign In for Pricing
View Details
CSF3R 3'UTR Luciferase Stable Cell Line
TU005098 1.0 mL

CSF3R 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
COL7A1 Protein Vector (Mouse) (pPM-C-HA)
16597024 500 ng

COL7A1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FBXO22 Antibody
E309193 200 µL

FBXO22 Antibody

Sign In for Pricing
View Details
SARS-CoV-2 S2 Monoclonal Antibody (2019-nCoV)
MBS2568509-01 0.05 mL

SARS-CoV-2 S2 Monoclonal Antibody (2019-nCoV)

Sign In for Pricing
View Details
SARS-CoV-2 S2 Monoclonal Antibody (2019-nCoV)
MBS2568509-02 0.1 mL

SARS-CoV-2 S2 Monoclonal Antibody (2019-nCoV)

Sign In for Pricing
View Details