Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA7 Peptide - C-terminal region

HOXA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOXA7, HOX1A

UniProt

P31268

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA7 Rabbit Polyclonal Antibody (orb583830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHRH (free acid)
HY-P4675-01 1 mg

LHRH (free acid)

Sign In for Pricing
View Details
LHRH (free acid)
HY-P4675-02 5 mg

LHRH (free acid)

Sign In for Pricing
View Details
LHRH (free acid)
HY-P4675-03 10 mg

LHRH (free acid)

Sign In for Pricing
View Details
Boc-2-chloro-D-beta-homophenylalanine
sc-285076 250 mg

Boc-2-chloro-D-beta-homophenylalanine

Sign In for Pricing
View Details
GCM1 (Glial Cells Missing Homolog 1, GCM Motif Protein 1, Chorion-specific Transcription Factor GCMa, GCMa) (MaxLight 750) discontinued
127235-ML750 100 µL

GCM1 (Glial Cells Missing Homolog 1, GCM Motif Protein 1, Chorion-specific Transcription Factor GCMa, GCMa) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PI 3 Kinase Class 3 Polyclonal Antibody, Cy5 Conjugated
bs-4159R-Cy5 100 µL

PI 3 Kinase Class 3 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details