Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Peptide - C-terminal region

PSMD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSMD4, MCB1

UniProt

P55036

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD4 Rabbit Polyclonal Antibody (orb583850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002801

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDON Rabbit Polyclonal Antibody
TA369944 100 µL

CDON Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4930571K23Rik Mouse Gene Knockout Kit (CRISPR)
KN500404 1 Kit

4930571K23Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IBMX
P019-1GM 1 g

IBMX

Sign In for Pricing
View Details
CDYL Polyclonal Antibody
E-AB-67742-01 60 µL

CDYL Polyclonal Antibody

Sign In for Pricing
View Details
CDYL Polyclonal Antibody
E-AB-67742-02 120 µL

CDYL Polyclonal Antibody

Sign In for Pricing
View Details
CDYL Polyclonal Antibody
E-AB-67742-03 200 µL

CDYL Polyclonal Antibody

Sign In for Pricing
View Details