Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Peptide - C-terminal region

PSMD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSMD4, MCB1

UniProt

P55036

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD4 Rabbit Polyclonal Antibody (orb583850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002801

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (SY5), CF568 conjugate, 0.1mg/mL
BNC680678-100 1x 100 µL

Involucrin (SY5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MDM2 (phospho S166) Antibody
OC-1026-01 50 μL

MDM2 (phospho S166) Antibody

Sign In for Pricing
View Details
MDM2 (phospho S166) Antibody
OC-1026-02 100 µL

MDM2 (phospho S166) Antibody

Sign In for Pricing
View Details
MDM2 (phospho S166) Antibody
OC-1026-03 1 mL

MDM2 (phospho S166) Antibody

Sign In for Pricing
View Details
2-Ethylpyridine
TRC-E931980-5G 5 g

2-Ethylpyridine

Sign In for Pricing
View Details
Glycerol 3-Phosphoethanolamine Sodium Salt (>90%)
TRC-G601596-5MG 5 mg

Glycerol 3-Phosphoethanolamine Sodium Salt (>90%)

Sign In for Pricing
View Details