NRL Peptide - C-terminal region
NRL Peptide - C-terminal region
Product Specifications
Product Name Alternative
NRL, D14S46E
UniProt
P54845
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NRL Rabbit Polyclonal Antibody (orb583899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005267767
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![UBA52 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D12]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1c7a6/imageurl/ta805177bm.webp)
TA805177BM 100 µL
UBA52 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D12]
Sign In for Pricing
View Details 
