Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF4B Peptide - N-terminal region

TAF4B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TAF4B, TAF2C2, TAFII105

UniProt

Q92750

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAF4B Rabbit Polyclonal Antibody (orb587951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005258397

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQINLSPTMLENVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC 336-F-A3-B7527 AC Signs
808130 Card of 1 Pictogram(s)

PIC 336-F-A3-B7527 AC Signs

Sign In for Pricing
View Details
DiagNano™ CuInZnS/ZnS Quantum Dots, 600 nm
DNG-N125 10 mg

DiagNano™ CuInZnS/ZnS Quantum Dots, 600 nm

Sign In for Pricing
View Details
Ncam1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4589707 1.0 µg DNA

Ncam1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal Cadherin-16 Antibody (CDH16/2125) [DyLight 680]
NBP2-79856FR 0.1 mL

Mouse Monoclonal Cadherin-16 Antibody (CDH16/2125) [DyLight 680]

Sign In for Pricing
View Details
MTERFD1 (MTERF3) Rabbit Polyclonal Antibody
TA319912 100 µg

MTERFD1 (MTERF3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD36 Antibody (JL2), FITC
MBS1583501-01 50 Tests

Anti-Human CD36 Antibody (JL2), FITC

Sign In for Pricing
View Details