Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF4B Peptide - N-terminal region

TAF4B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TAF4B, TAF2C2, TAFII105

UniProt

Q92750

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAF4B Rabbit Polyclonal Antibody (orb587951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005258397

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQINLSPTMLENVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine beta Lactoglobulin antibody
MBS534194-01 1 mg

Bovine beta Lactoglobulin antibody

Sign In for Pricing
View Details
Bovine beta Lactoglobulin antibody
MBS534194-02 5x 1 mg

Bovine beta Lactoglobulin antibody

Sign In for Pricing
View Details
Interleukin 33 (IL-33, C9orf26, DKFZp586H0523, DVS27, IL1F11, IL-1F11, Interleukin-1 Family Member 11, Interleukin-33, NFEHEV, NFHEV, NF-HEV, Nuclear Factor from High Endothelial Venules, RP11-575C20.2) (AP) discontinued
I7663-97G-AP 100 µL

Interleukin 33 (IL-33, C9orf26, DKFZp586H0523, DVS27, IL1F11, IL-1F11, Interleukin-1 Family Member 11, Interleukin-33, NFEHEV, NFHEV, NF-HEV, Nuclear Factor from High Endothelial Venules, RP11-575C20.2) (AP) discontinued

Sign In for Pricing
View Details
Human PNP ELISA Kit PicoKine®
EK2258 96 Well With Removable Strips

Human PNP ELISA Kit PicoKine®

Sign In for Pricing
View Details
Hsa-miR-6892-5p miRNA Agomir
orb1919110-01 5 nmol

Hsa-miR-6892-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6892-5p miRNA Agomir
orb1919110-02 10 nmol

Hsa-miR-6892-5p miRNA Agomir

Sign In for Pricing
View Details