TESC Peptide - N-terminal region
TESC Peptide - N-terminal region
Product Specifications
Product Name Alternative
TESC, CHP3
UniProt
Q96BS2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TESC Rabbit Polyclonal Antibody (orb587969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060369
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6468534-01 0.1 mL
CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075) APC
Sign In for Pricing
View Details MBS6468534-02 5x 0.1 mL
CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075) APC
Sign In for Pricing
View Details LC413184 20 µg
Septin 11 (SEPT11) (NM_018243) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6199462-01 0.1 mL
AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (MaxLight 49
Sign In for Pricing
View Details MBS6199462-02 5x 0.1 mL
AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (MaxLight 49
Sign In for Pricing
View Details 