Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESC Peptide - N-terminal region

TESC Peptide - N-terminal region

Product Specifications

Product Name Alternative

TESC, CHP3

UniProt

Q96BS2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TESC Rabbit Polyclonal Antibody (orb587969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060369

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1321 (NM_001000792) Rat Untagged Clone
RN208736 10 µg

Olr1321 (NM_001000792) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 - AcalephFluor750
CSA4147-01 100 µL

Rabbit Anti-Human IgG F (ab') 2 - AcalephFluor750

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 - AcalephFluor750
CSA4147-02 500 μL

Rabbit Anti-Human IgG F (ab') 2 - AcalephFluor750

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 - AcalephFluor750
CSA4147-03 1 mL

Rabbit Anti-Human IgG F (ab') 2 - AcalephFluor750

Sign In for Pricing
View Details
ACSBG2 (NM_030924) Human Over-expression Lysate
LY410659 100 µg

ACSBG2 (NM_030924) Human Over-expression Lysate

Sign In for Pricing
View Details
Aromadendrin 7-o-rhamnoside
UCA13541-01 10 mg

Aromadendrin 7-o-rhamnoside

Sign In for Pricing
View Details