Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPYL5 Peptide - N-terminal region

TSPYL5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TSPYL5, KIAA1750

UniProt

Q86VY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSPYL5 Rabbit Polyclonal Antibody (orb587991) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_277047

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWGGLEAAASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prealbumin/TTR Rabbit Polyclonal Antibody (Fluoro647)
orb3075926 100 µg

Prealbumin/TTR Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Mouse HCK siRNA
abx919152-01 15 nmol

Mouse HCK siRNA

Sign In for Pricing
View Details
Mouse HCK siRNA
abx919152-02 30 nmol

Mouse HCK siRNA

Sign In for Pricing
View Details
Recombinant Human CYP7B1 Protein - (Dry Ice)
H00009420-P01-25ug 25 µg

Recombinant Human CYP7B1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human PTH1-34
HEHOP-1601 100 µg

Recombinant Human PTH1-34

Sign In for Pricing
View Details
Desmoglein 3 Rabbit Polyclonal Antibody (APC)
orb1007967 100 µL

Desmoglein 3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details