Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPYL5 Peptide - N-terminal region

TSPYL5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TSPYL5, KIAA1750

UniProt

Q86VY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSPYL5 Rabbit Polyclonal Antibody (orb587991) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_277047

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWGGLEAAASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLL2 Peptide
DF9646-BP 1 mg

MLL2 Peptide

Sign In for Pricing
View Details
5- (aminosulfonyl) -2-furoic acid
sc-350203 250 mg

5- (aminosulfonyl) -2-furoic acid

Sign In for Pricing
View Details
HRH4 Polyclonal Conjugated Antibody
orb1628882 100 µL

HRH4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
N (alpha) -Acetylfusarinines
T33551-01 100 mg

N (alpha) -Acetylfusarinines

Sign In for Pricing
View Details
N (alpha) -Acetylfusarinines
T33551-02 25 mg

N (alpha) -Acetylfusarinines

Sign In for Pricing
View Details
N (alpha) -Acetylfusarinines
T33551-03 50 mg

N (alpha) -Acetylfusarinines

Sign In for Pricing
View Details