Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAI2 Peptide - C-terminal region

RAI2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAI2

UniProt

Q9Y5P3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAI2 Rabbit Polyclonal Antibody (orb587992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068557

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMLSQPNHPSGEVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyruvate kinase isozymes M2 (PKM2) Magnetic Fluorescence Assay Kit
MBS2155875-01 96 Tests

Pyruvate kinase isozymes M2 (PKM2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Pyruvate kinase isozymes M2 (PKM2) Magnetic Fluorescence Assay Kit
MBS2155875-02 5x 96 Tests

Pyruvate kinase isozymes M2 (PKM2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Pyruvate kinase isozymes M2 (PKM2) Magnetic Fluorescence Assay Kit
MBS2155875-03 10x 96 Tests

Pyruvate kinase isozymes M2 (PKM2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Human PYCR1 Protein
ARP3593-01 10 µg

Recombinant Human PYCR1 Protein

Sign In for Pricing
View Details
Recombinant Human PYCR1 Protein
ARP3593-02 50 µg

Recombinant Human PYCR1 Protein

Sign In for Pricing
View Details
Recombinant Human PYCR1 Protein
ARP3593-03 100 µg

Recombinant Human PYCR1 Protein

Sign In for Pricing
View Details