RAI2 Peptide - C-terminal region
RAI2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RAI2
UniProt
Q9Y5P3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAI2 Rabbit Polyclonal Antibody (orb587992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068557
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EMLSQPNHPSGEVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683225-100 1x 100 µL
Prohibitin (Mitochondrial Marker) (PHB/3225), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN200463RB 1 Kit
Heme Oxygenase 1 (HMOX1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
LC402026 20 µg
Myotilin (MYOT) (NM_006790) Human Over-expression Lysate
Sign In for Pricing
View Details 
GA110050 1 Kit
Human glycerol 3 phosphate permease (SLC37A1) activation kit by CRISPRa
Sign In for Pricing
View Details