ALS2CL Peptide - C-terminal region
ALS2CL Peptide - C-terminal region
Product Specifications
Product Name Alternative
ALS2CL, hCG_2043002
UniProt
G5E9N5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ALS2CL Rabbit Polyclonal Antibody (orb588004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EPSQPPDCRCAEYTFQAEGRLCQATYEGEWCRGRPHGKGTLKWPDGRNHV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1352040-01 0.02 mg (E-Coli)
Recombinant Xylella fastidiosa Uncharacterized protein XF_1569/XF_1674 (XF_1569)
Sign In for Pricing
View Details MBS1352040-02 0.02 mg (Yeast)
Recombinant Xylella fastidiosa Uncharacterized protein XF_1569/XF_1674 (XF_1569)
Sign In for Pricing
View Details MBS1352040-03 0.1 mg (E-Coli)
Recombinant Xylella fastidiosa Uncharacterized protein XF_1569/XF_1674 (XF_1569)
Sign In for Pricing
View Details MBS1352040-04 0.1 mg (Yeast)
Recombinant Xylella fastidiosa Uncharacterized protein XF_1569/XF_1674 (XF_1569)
Sign In for Pricing
View Details MBS1352040-05 0.02 mg (Baculovirus)
Recombinant Xylella fastidiosa Uncharacterized protein XF_1569/XF_1674 (XF_1569)
Sign In for Pricing
View Details MBS1352040-06 0.02 mg (Mammalian-Cell)
Recombinant Xylella fastidiosa Uncharacterized protein XF_1569/XF_1674 (XF_1569)
Sign In for Pricing
View Details