Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2CL Peptide - C-terminal region

ALS2CL Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALS2CL, hCG_2043002

UniProt

G5E9N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2CL Rabbit Polyclonal Antibody (orb588004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSQPPDCRCAEYTFQAEGRLCQATYEGEWCRGRPHGKGTLKWPDGRNHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ATP synthase subunit b (atpF)
MBS1096016 Inquire

Recombinant ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
7beta,27-dihydroxy Cholesterol
MBS5798002 Inquire

7beta,27-dihydroxy Cholesterol

Sign In for Pricing
View Details
Rabbit Monoclonal VAMP-1 Antibody (1A3K6)
NBP3-16212-20ul 20 µL

Rabbit Monoclonal VAMP-1 Antibody (1A3K6)

Sign In for Pricing
View Details
Olfr698 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
33371114 3x 1.0 µg

Olfr698 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human H2BC26 qPCR Primer Pair
QH61993S 200 Tests

Human H2BC26 qPCR Primer Pair

Sign In for Pricing
View Details
Guinea pig T-cell-specific surface glycoprotein CD28 (CD28) ELISA Kit
MBS7215142-01 48 Well

Guinea pig T-cell-specific surface glycoprotein CD28 (CD28) ELISA Kit

Sign In for Pricing
View Details