Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBRAP1 Peptide - C-terminal region

TGFBRAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TGFBRAP1

UniProt

Q8WUH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGFBRAP1 Rabbit Polyclonal Antibody (orb588009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVIDKRLQKEEYHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Allylamino) nicotinic acid
OR1069371-01 50 mg

2- (Allylamino) nicotinic acid

Sign In for Pricing
View Details
2- (Allylamino) nicotinic acid
OR1069371-02 100 mg

2- (Allylamino) nicotinic acid

Sign In for Pricing
View Details
2- (Allylamino) nicotinic acid
OR1069371-03 250 mg

2- (Allylamino) nicotinic acid

Sign In for Pricing
View Details
2- (Allylamino) nicotinic acid
OR1069371-04 1 g

2- (Allylamino) nicotinic acid

Sign In for Pricing
View Details
GPRC6A Antibody, FITC conjugated
A57603-50UG 50 µg

GPRC6A Antibody, FITC conjugated

Sign In for Pricing
View Details
African malaria mosquito CLIPB17 Rabbit Polyclonal Antibody (PE)
orb2572101 200 µL

African malaria mosquito CLIPB17 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details