Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBRAP1 Peptide - C-terminal region

TGFBRAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TGFBRAP1

UniProt

Q8WUH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGFBRAP1 Rabbit Polyclonal Antibody (orb588009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVIDKRLQKEEYHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1q-C Polyclonal Antibody
orb2656933-01 50 µL

C1q-C Polyclonal Antibody

Sign In for Pricing
View Details
C1q-C Polyclonal Antibody
orb2656933-02 100 µL

C1q-C Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human NOTUM Antibody (SAA1845)
MBS1570805-01 0.1 mg

Anti-Human NOTUM Antibody (SAA1845)

Sign In for Pricing
View Details
Anti-Human NOTUM Antibody (SAA1845)
MBS1570805-02 1 mg

Anti-Human NOTUM Antibody (SAA1845)

Sign In for Pricing
View Details
Anti-Human NOTUM Antibody (SAA1845)
MBS1570805-03 5x 1 mg

Anti-Human NOTUM Antibody (SAA1845)

Sign In for Pricing
View Details
Nucleophosmin rabbit pAb
ES2991-01 50 µL

Nucleophosmin rabbit pAb

Sign In for Pricing
View Details