Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39L Peptide - C-terminal region

CAB39L Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAB39L

UniProt

Q5TAW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAB39L Rabbit Polyclonal Antibody (orb588015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-
LA-2201-1 1 mg

Alkaline Phosphatase Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
PYK2 (PTK2B) Rabbit Polyclonal Antibody
AP06298PU-N 100 µg

PYK2 (PTK2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,4-Dihydroxy-2-nitrobenzaldehyde
TRC-D454173-500MG 500 mg

3,4-Dihydroxy-2-nitrobenzaldehyde

Sign In for Pricing
View Details
PE Anti-Human IgD Antibody[IA6-2]
E-AB-F1171D-01 20 Tests

PE Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details
PE Anti-Human IgD Antibody[IA6-2]
E-AB-F1171D-02 100 Tests

PE Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details
PE Anti-Human IgD Antibody[IA6-2]
E-AB-F1171D-03 2x 100 Tests

PE Anti-Human IgD Antibody[IA6-2]

Sign In for Pricing
View Details