Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39L Peptide - C-terminal region

CAB39L Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAB39L

UniProt

Q5TAW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAB39L Rabbit Polyclonal Antibody (orb588015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein
TP324784M 100 µg

IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein

Sign In for Pricing
View Details
Hexanedioic-d8 Acid
TRC-A291591-5MG 5 mg

Hexanedioic-d8 Acid

Sign In for Pricing
View Details
Recombinant DARS Antibody
RC-6866-01 50 μL

Recombinant DARS Antibody

Sign In for Pricing
View Details
Recombinant DARS Antibody
RC-6866-02 100 µL

Recombinant DARS Antibody

Sign In for Pricing
View Details
Recombinant DARS Antibody
RC-6866-03 1 mL

Recombinant DARS Antibody

Sign In for Pricing
View Details
FKLF / KLF11 (KLF11) Rabbit Polyclonal Antibody
TA377833 100 µL

FKLF / KLF11 (KLF11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details