Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB3 Peptide - C-terminal region

GNB3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GNB3

UniProt

P16520

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNB3 Rabbit Polyclonal Antibody (orb326391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002066

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6536006 1.0 µg DNA

Ttc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Anti-CCNDBP1 Antibody
A06604-3 100 µL

Anti-CCNDBP1 Antibody

Sign In for Pricing
View Details
REXO2, ID (REXO2, SFN, SMFN, Oligoribonuclease, mitochondrial, RNA exonuclease 2 homolog, Small fragment nuclease) (MaxLight 550) discontinued
040973-ML550 100 µL

REXO2, ID (REXO2, SFN, SMFN, Oligoribonuclease, mitochondrial, RNA exonuclease 2 homolog, Small fragment nuclease) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Phospho-MSK1 (Ser376) Colorimetric Cell-Based ELISA Kit (OKAG02002)
OKAG02002 2x 96 Well

Phospho-MSK1 (Ser376) Colorimetric Cell-Based ELISA Kit (OKAG02002)

Sign In for Pricing
View Details
MCM6 Rabbit Monoclonal Antibody [Clone ID: 23GB2005]
TA424965 100 µL

MCM6 Rabbit Monoclonal Antibody [Clone ID: 23GB2005]

Sign In for Pricing
View Details
Xanthine For Biochemistry
122060 25 25 g

Xanthine For Biochemistry

Sign In for Pricing
View Details