GNB3 Peptide - C-terminal region
GNB3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GNB3
UniProt
P16520
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GNB3 Rabbit Polyclonal Antibody (orb326391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002066
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6400808 1.0 µg DNA
LOC378467 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
DHC04807-01 50 mg
2-Methyl-5- (1,2,3,6-tetrahydropyridin-4-yl) pyridine dihydrochloride
Sign In for Pricing
View Details DHC04807-02 0.5 g
2-Methyl-5- (1,2,3,6-tetrahydropyridin-4-yl) pyridine dihydrochloride
Sign In for Pricing
View Details 