Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGP Peptide - middle region

PIGP Peptide - middle region

Product Specifications

Product Name Alternative

PIGP, DCRC, DSCR5, DSCRC, NPD010

UniProt

P57054

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGP Rabbit Polyclonal Antibody (orb586199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL3 CRISPR Activation Plasmid (h)
sc-409880-ACT 20 µg

KLHL3 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
TDRD12 Rabbit Polyclonal Antibody (Biotin)
orb2084917 100 µL

TDRD12 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mmu-miR-107-5p agomir
HY-R02570A-01 5 nmol

Mmu-miR-107-5p agomir

Sign In for Pricing
View Details
Mmu-miR-107-5p agomir
HY-R02570A-02 20 nmol

Mmu-miR-107-5p agomir

Sign In for Pricing
View Details
Mouse Redrum activation kit by CRISPRa
GA210754 1 Kit

Mouse Redrum activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-ACHE Antibody (C-Terminus)
B2020312 80 µL

Anti-ACHE Antibody (C-Terminus)

Sign In for Pricing
View Details