Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGP Peptide - middle region

PIGP Peptide - middle region

Product Specifications

Product Name Alternative

PIGP, DCRC, DSCR5, DSCRC, NPD010

UniProt

P57054

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGP Rabbit Polyclonal Antibody (orb586199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THRAP3 siRNA (Human)
CRH6704-01 15 nmol

THRAP3 siRNA (Human)

Sign In for Pricing
View Details
THRAP3 siRNA (Human)
CRH6704-02 30 nmol

THRAP3 siRNA (Human)

Sign In for Pricing
View Details
ATG10 293 Cell Lysate
405354 0.1 mg

ATG10 293 Cell Lysate

Sign In for Pricing
View Details
ARHGAP16P Adenovirus (Human)
12282051 1.0 mL

ARHGAP16P Adenovirus (Human)

Sign In for Pricing
View Details
Olfr113 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4298905 3x 1.0 µg

Olfr113 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Microscope Slides Eye Pectin
4040800/29 1 Each

Microscope Slides Eye Pectin

Sign In for Pricing
View Details