CDV3 Peptide - middle region
CDV3 Peptide - middle region
Product Specifications
Product Name Alternative
CDV3, H41
UniProt
Q9UKY7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDV3 Rabbit Polyclonal Antibody (orb326594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV686867 1.0 µg DNA
CD9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details 
MBS1317448-01 0.02 mg (E-Coli)
Recombinant Human Nitric oxide-associated protein 1 (NOA1)
Sign In for Pricing
View Details