Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIAO3 Peptide - middle region

CIAO3 Peptide - middle region

Product Specifications

Product Name Alternative

PRN, HPRN, IOP1, NAR1, LET1L, NARFL

UniProt

Q9H6Q4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIAO3 Rabbit Polyclonal Antibody (orb586629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005255558

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MACPSGCLNGGGQLQAPDRPSRELLQHVERLYGMVRAEAPEDAPGVQELY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2B1 antibody
FNab02693 100 µg

EIF2B1 antibody

Sign In for Pricing
View Details
LRRCC1 Adenovirus (Mouse)
27707054 1.0 mL

LRRCC1 Adenovirus (Mouse)

Sign In for Pricing
View Details
AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)
abx334777-01 20 µg

AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)

Sign In for Pricing
View Details
AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)
abx334777-02 50 µg

AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)

Sign In for Pricing
View Details
AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)
abx334777-03 100 µg

AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)

Sign In for Pricing
View Details
AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)
abx334777-04 200 µg

AT-Rich Interactive Domain Containing Protein 1A (ARID1A) Antibody (FITC)

Sign In for Pricing
View Details